- SF3B14 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87430
- CGI-110, HSPC175, Ht006, P14, SAP14, SAP14a, SF3B14, SF3B14a
- This antibody was developed against Recombinant Protein corresponding to amino acids: MAMQAAKRAN IRLPPEVNRI LYIRNLPYKI TAEEMYDIFG KYGPIRQIRV GNTPETRGTA YVV
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- 0.1 ml (also 25ul)
- Rabbit
- SF3B14
- splicing factor 3b subunit 6
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVV
Specifications/Features
Available conjugates: Unconjugated